Protein Purification

Kits, columns, gels, reagents, enzymes, inhibitors, and other assorted products for use with protein purification procedures.

New Lab Start-Up (30)
Offers (448)

special interests

Available on GSA/VA Contract (215)
Fast Shipping (50)
Greener Choice (197)
Production Products (228)
Science Education (9)
Small and Specialty Supplier (787)

Form

Agarose Bead (9)
Amorphous Solid (6)
Bulk Media (3)
Crystalline Film (1)
Crystalline Solid (55)
Dry (2)
Film (3)

Show all

Type

1-step Human Coupled IVT Kit (2)
1-step Human High-yield Maxi IVT Kit (1)
1-step Human High-yield Mini IVT Kit (2)
96-well Filter Plate (2)
Affinity Matrix (62)
Affinity Membrane (1)
Affinity Resin (6)

Show all

Product Line

AAV-MAX (2)
ATTO-TAG (4)
ActivX (7)
ActivX, Pierce (1)
Ambion (4)
AminoLink (9)
Brij (5)

Show all

Particle Size

>40 μm (1)
∼ 3 μm (1)
∼9 μm¹ (2)
1 μm (18)
1 to 3 μm (4)
1 to 4 μm (2)
10 μm (4)

Show all

Product Type

Antibody Coated Bead (1)
Benzamidine FF Column (3)
Blue HP Columns (2)
Buffer (1)
Calibration Kit (2)
Cell Dissociation (1)
Cell Enrichment Column (2)

Show all

Capacity (Metric)

≥1.2 mg Biotinylated BSA Binding per mL Resin (2)
≥20 mg Jacalin per mL of Settled Resin (1)
≥25 mg per mL Coupling (2)
≥30 mg per mL Coupling (1)
≥50 mg Human IgG per mL Resin Binding (2)
≥6 mg Human IgG Coupling per mL Resin (1)
> 100 mg IgG/mL resin (2)

Show all

Column Type

Affinity Column (39)
Column Accesory (13)
Empty Chromatography Column (22)
Empty HPLC Column (6)
Gel Filtration Column (3)
Gravity Column (4)
HIC Column (3)

Show all

Flow Rate

≥40 cm/hr. (1)
>100 cm/hr. (2)
>11 cm/hr. (1)
>125 cm/hr. (3)
>150 cm/hr. (3)
>47 cm/hr. (2)
>480 cm/hr. (2)

Show all

Matrix

15Q Chromatography Media (3)
Affinity Resin (11)
Capto AVB (2)
Capto L Chromatography media (1)
Capto Q Chromatography Media (2)
Chelating Sepharose (1)
DEAE Sephacel (1)

Show all

Expression System

Baculovirus (7)
Cell-Free (5)
Mammalian (1)
Yeast (1)

Search Within Results

1,141 – 1,155 of 12,534 results

1,141

MilliporeSigma™ Calbiochem™ β-Glycerophosphate, Disodium Salt, Pentahydrate

A phosphate group donor in matrix mineralization studies that acts as a protein phosphatase inhibitor.

Pricing & Availability
Specifications

Content And Storage	Protect from moisture
CAS	13408-09-8
Form	Solid
Target Proteins	protein phosphatase
Solubility	H₂O
Color	White
Purity	99% by 31P NMR
Molecular Formula	C₃H₇O₆PNa₂·5H₂O
Formula Weight	306.1g/mol

1,142

MilliporeSigma™ Calbiochem™ PCSK9 Inhibitor, EGF-A

A 42-mer synthetic peptide (GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2) that contains a calcium binding site of EGF-A

Pricing & Availability

1,143

Promotions Available

Thermo Scientific™ Pierce™ GST Spin Purification Kit, 3 mL

Purify GST-tagged recombinant fusion proteins from cell lysates using glutathione (GSH) beaded agarose affinity purification resins, spin columns and plates.

Pricing & Availability

1,144

Promotions Available

Thermo Scientific™ SulfoLink™ Coupling Resin

Covalently immobilize cysteine-peptides or proteins (sulfhydryl-ligands) for affinity purification using iodoacetyl-activated agarose beads and columns.

Pricing & Availability
Specifications

Stationary Phase	Haloacetyl
Type	Resin
Content And Storage	Upon receipt store product in the dark at 4°C. Product is shipped at ambient temperature.
Format	Bottle
Column Type	Affinity, Agarose Resin
Sufficient For	1 mg Peptide or 10 mg Antibody per mL of Resin
Product Line	SulfoLink

1,145

Promotions Available

Thermo Scientific™ Pierce™ HA-Tag IP/Co-IP Kit

Anti-HA antibody agarose beads and complete reagent set to easily co-immunoprecipitate protein interactions involving HA-tagged fusion proteins.

Pricing & Availability

1,146

Promotions Available

Thermo Scientific™ AminoLink™ Plus Immobilization Kit, 2 mL

Covalently couple antibodies and other proteins via primary amines (-NH2) for affinity purification with these aldehyde-activated agarose beads.

Pricing & Availability
Specifications

Stationary Phase	Aldehyde
Type	Immobilization Kit
Target	Antibody, Proteins through Primary Amine
Format	Spin Column
Column Type	Affinity, Agarose Resin
Capacity (Metric)	2 to 40 mg of protein Immobilization per Column
Sufficient For	2 to 40 mg of Protein per Column
Product Line	AminoLink

1,147

Promotions Available

Thermo Scientific™ Micrococcal Nuclease Solution (≥100 U/μL)

Remove nucleic acids from cell lysates, release chromatin-bound proteins and shear chromatin for chromatin immunoprecipitation (ChIP) using micrococcal nuclease.

Pricing & Availability

1,148

Promotions Available

Thermo Scientific™ CarboxyLink™ Coupling Resin

Covalently immobilize peptide antigens and other carboxylate ligands for affinity purification using DADPA-activated agarose beads and EDC crosslinker.

Pricing & Availability

1,149

Promotions Available

Thermo Scientific™ Pierce™ Protein A/G Magnetic Agarose Beads

Thermo Scientific™ Pierce™ Protein A/G Magnetic Agarose Beads provide a fast, convenient method for purification of immunoglobulins from serum, cell culture supernatant, or ascites

Pricing & Availability
Specifications

Particle Size	25 to 30 μm
Shipping Condition	Wet Ice
Stationary Phase	Protein A/G
Type	Magnetic Agarose Bead
Format	Bottle
Protein Form	Recombinant
Form	Liquid
Concentration	Slurry: 25%
Product Line	Pierce

1,150

MilliporeSigma™ Calbiochem™ Diethyl Pyrocarbonate

Inhibits ryanodine binding to ryanodine/Ca2+ receptor channel in skeletal muscle in a dose- and time-dependent manner and increases the Ca2+ permeability of SR vesicles.

Pricing & Availability
Specifications

Content And Storage	Protect from light
CAS	1609-47-8
Form	Liquid
Target Proteins	Inhibits ryanodine binding to ryanodine/Ca2+ receptor channel in skeletal muscle
Solubility	CHCl₃ or EtOH
Color	Clear Colorless
Purity	97% by titration
Molecular Formula	C₆H₁₀O₅
Formula Weight	162.1g/mol

1,151

MilliporeSigma™ PureProteome™ Streptavidin Magnetic Bead System

Powerful bead system helps researchers to purify biotinylated molecules with high capacity, high specificity at an economical price

Pricing & Availability

1,152

Thermo Scientific™ CHAPSO (3-[(3-cholamidopropyl)dimethylammonio]-2-hydroxy-1-propanesulfonate)

CHAPSO, or 3-[(3-cholamidopropyl)dimethylammonio]-2-hydroxy-1-propanesulfonate, is a zwitterionic detergent commonly used in biochemical and biophysical research.

Pricing & Availability
Specifications

Content And Storage	Store below -20°C.
CAS	82473-24-3
Form	Lyophilized
Product Type	Detergent
Molecular Weight (g/mol)	630.9
Reagent Type	Detergent
Solubility	≥0.5 M (in water at 20°C)
Color	White
Purification Target	Proteins
Molecular Formula	C₃₂H₅₈N₂O₈S

1,153

MilliporeSigma™ Calbiochem™ CTOP

A potent antagonist highly selective forμ opioid receptor (K_i

Pricing & Availability

1,154

MP Biomedicals™ Ovine Testes

Used in conjunction with collagenase to dissociate the extracellular matrix between cells of animal tissue, in order to release viable cells for use in tissue culture.

Pricing & Availability

1,155

MilliporeSigma™ Novagen™ BugBuster™ plus Benzonase™ Nuclease

Used for protein purification.

Pricing & Availability

Protein Purification

Filtered Search Results

Narrow Results

Thermo Scientific™ Pierce™ HA-Tag IP/Co-IP Kit GSA/VA ContractAvailable on GSA/VA contract for Federal Government customers.Learn More

Thermo Scientific™ Micrococcal Nuclease Solution (≥100 U/μL) GSA/VA ContractAvailable on GSA/VA contract for Federal Government customers.Learn More

Thermo Scientific™ Pierce™ HA-Tag IP/Co-IP Kit

Thermo Scientific™ Micrococcal Nuclease Solution (≥100 U/μL)